o 6a]@sddlZddlZddlZddlZddlZddlZddlZddlZddlm Z m Z ddl m Z ddlZddlmZddlmZddlmZddlmZmZdd lmZmZdd lmZdd lmZm Z m!Z!m"Z"m#Z#m$Z$m%Z%m&Z&m'Z'm(Z(m)Z)dd l*m+Z+m,Z,m-Z-m.Z.m/Z/m0Z0ed ddZ1gdZ2ej3ej4d dZ4GdddZ5ddZ6Gddde Z7ed   dNddZ8dOddZ9e4e9dPdd Z:d!d"Z;e4e;d#d$ZdQd)d*Z?d+d,Z@d-ZA   dRdd.d/d0ZBeed eCd1ddddddd2df dd.d3d4ZDe4eBeDZE   dSd5d6ZFe4eF : dTdd?ZH       dVdd.d@dAZIeed eCd1dddddddddd:JeKe jLdBdddCdddddd2fdd.dDdEZMe4eIeMZNdFdGZOdHdIZPdJdKZQdLdMZRdS)WN) itemgetterindex)Mapping)format) DataSource) overrides)packbits unpackbits)set_array_function_like_doc set_module) recursive) LineSplitter NameValidatorStringConverterConverterErrorConverterLockErrorConversionWarning_is_string_likehas_nested_fields flatten_dtype easy_dtype _decode_line)asbytesasstr asunicode os_fspath os_PathLikepicklenumpycOs tjdtddtj|i|S)Nz0np.loads is deprecated, use pickle.loads instead stacklevel)warningswarnDeprecationWarningrloads)argskwargsr)1/usr/lib/python3/dist-packages/numpy/lib/npyio.pyr&s r&)savetxtloadtxt genfromtxt ndfromtxt mafromtxt recfromtxt recfromcsvloadr&savesavezsavez_compressedr r fromregexr)modulec@s(eZdZdZddZddZddZdS) BagObjam BagObj(obj) Convert attribute look-ups to getitems on the object passed in. Parameters ---------- obj : class instance Object on which attribute look-up is performed. Examples -------- >>> from numpy.lib.npyio import BagObj as BO >>> class BagDemo: ... def __getitem__(self, key): # An instance of BagObj(BagDemo) ... # will call this method when any ... # attribute look-up is required ... result = "Doesn't matter what you want, " ... return result + "you're gonna get this" ... >>> demo_obj = BagDemo() >>> bagobj = BO(demo_obj) >>> bagobj.hello_there "Doesn't matter what you want, you're gonna get this" >>> bagobj.I_can_be_anything "Doesn't matter what you want, you're gonna get this" cCst||_dSN)weakrefproxy_obj)selfobjr)r)r*__init__QszBagObj.__init__cCs,z t|d|WStyt|dw)Nr<)object__getattribute__KeyErrorAttributeError)r=keyr)r)r*rAUs   zBagObj.__getattribute__cCstt|dS)z Enables dir(bagobj) to list the files in an NpzFile. This also enables tab-completion in an interpreter or IPython. r<)listr@rAkeysr=r)r)r*__dir__[szBagObj.__dir__N)__name__ __module__ __qualname____doc__r?rArHr)r)r)r*r83s  r8cOs:t|ds t|}ddl}d|d<|j|g|Ri|S)z Create a ZipFile. Allows for Zip64, and the `file` argument can accept file, str, or pathlib.Path objects. `args` and `kwargs` are passed to the zipfile.ZipFile constructor. readrNT allowZip64)hasattrrzipfileZipFile)filer'r(rPr)r)r*zipfile_factoryds rSc@sneZdZdZdZdZ  dddZddZdd Zd d Z d d Z ddZ ddZ ddZ ddZddZdS)NpzFilear NpzFile(fid) A dictionary-like object with lazy-loading of files in the zipped archive provided on construction. `NpzFile` is used to load files in the NumPy ``.npz`` data archive format. It assumes that files in the archive have a ``.npy`` extension, other files are ignored. The arrays and file strings are lazily loaded on either getitem access using ``obj['key']`` or attribute lookup using ``obj.f.key``. A list of all files (without ``.npy`` extensions) can be obtained with ``obj.files`` and the ZipFile object itself using ``obj.zip``. Attributes ---------- files : list of str List of all files in the archive with a ``.npy`` extension. zip : ZipFile instance The ZipFile object initialized with the zipped archive. f : BagObj instance An object on which attribute can be performed as an alternative to getitem access on the `NpzFile` instance itself. allow_pickle : bool, optional Allow loading pickled data. Default: False .. versionchanged:: 1.16.3 Made default False in response to CVE-2019-6446. pickle_kwargs : dict, optional Additional keyword arguments to pass on to pickle.load. These are only useful when loading object arrays saved on Python 2 when using Python 3. Parameters ---------- fid : file or str The zipped archive to open. This is either a file-like object or a string containing the path to the archive. own_fid : bool, optional Whether NpzFile should close the file handle. Requires that `fid` is a file-like object. Examples -------- >>> from tempfile import TemporaryFile >>> outfile = TemporaryFile() >>> x = np.arange(10) >>> y = np.sin(x) >>> np.savez(outfile, x=x, y=y) >>> _ = outfile.seek(0) >>> npz = np.load(outfile) >>> isinstance(npz, np.lib.io.NpzFile) True >>> sorted(npz.files) ['x', 'y'] >>> npz['x'] # getitem access array([0, 1, 2, 3, 4, 5, 6, 7, 8, 9]) >>> npz.f.x # attribute lookup array([0, 1, 2, 3, 4, 5, 6, 7, 8, 9]) NFcCs~t|}||_g|_||_||_|jD]}|dr'|j|ddq|j|q||_t ||_ |r=||_ dSdS)N.npy) rSnamelist_filesfiles allow_pickle pickle_kwargsendswithappendzipr8ffid)r=r`own_fidrZr[_zipxr)r)r*r?s     zNpzFile.__init__cCs|Sr9r)rGr)r)r* __enter__szNpzFile.__enter__cC |dSr9close)r=exc_type exc_value tracebackr)r)r*__exit__ zNpzFile.__exit__cCs>|jdur |jd|_|jdur|jd|_d|_dS)z" Close the file. N)r^rgr`r_rGr)r)r*rgs     z NpzFile.closecCrer9rfrGr)r)r*__del__rlzNpzFile.__del__cC t|jSr9)iterrYrGr)r)r*__iter__ zNpzFile.__iter__cCrnr9)lenrYrGr)r)r*__len__rqzNpzFile.__len__cCsd}||jvr d}n ||jvrd}|d7}|rD|j|}|ttj}||tjkr>|j|}tj ||j |j dS|j|St d|)NFTrUrZr[z%s is not a file in the archive) rXrYr^openrMrrr MAGIC_PREFIXrg read_arrayrZr[rB)r=rDmemberbytesmagicr)r)r* __getitem__s$       zNpzFile.__getitem__cCtjdtdd|S)NziNpzFile.iteritems is deprecated in python 3, to match the removal of dict.itertems. Use .items() instead.r r!)r#r$r%itemsrGr)r)r* iteritems  zNpzFile.iteritemscCr|)NzgNpzFile.iterkeys is deprecated in python 3, to match the removal of dict.iterkeys. Use .keys() instead.r r!)r#r$r%rFrGr)r)r*iterkeysrzNpzFile.iterkeys)FFN)rIrJrKrLr^r`r?rdrkrgrmrprsr{r~rr)r)r)r*rTss B  " rTFTASCIIc Csz|dvrtdt||d}t}t|dr|}d}n |tt|d}d}d} d } tt j } | | } | t | t|  d | | sM| | rb|t||||d } | Wd S| t j kr|rwt j||d Wd St j|||dWd S|stdztj|fi|WWd Sty}z tdt||d }~ww1swYd S)a Load arrays or pickled objects from ``.npy``, ``.npz`` or pickled files. .. warning:: Loading files that contain object arrays uses the ``pickle`` module, which is not secure against erroneous or maliciously constructed data. Consider passing ``allow_pickle=False`` to load data that is known not to contain object arrays for the safer handling of untrusted sources. Parameters ---------- file : file-like object, string, or pathlib.Path The file to read. File-like objects must support the ``seek()`` and ``read()`` methods. Pickled files require that the file-like object support the ``readline()`` method as well. mmap_mode : {None, 'r+', 'r', 'w+', 'c'}, optional If not None, then memory-map the file, using the given mode (see `numpy.memmap` for a detailed description of the modes). A memory-mapped array is kept on disk. However, it can be accessed and sliced like any ndarray. Memory mapping is especially useful for accessing small fragments of large files without reading the entire file into memory. allow_pickle : bool, optional Allow loading pickled object arrays stored in npy files. Reasons for disallowing pickles include security, as loading pickled data can execute arbitrary code. If pickles are disallowed, loading object arrays will fail. Default: False .. versionchanged:: 1.16.3 Made default False in response to CVE-2019-6446. fix_imports : bool, optional Only useful when loading Python 2 generated pickled files on Python 3, which includes npy/npz files containing object arrays. If `fix_imports` is True, pickle will try to map the old Python 2 names to the new names used in Python 3. encoding : str, optional What encoding to use when reading Python 2 strings. Only useful when loading Python 2 generated pickled files in Python 3, which includes npy/npz files containing object arrays. Values other than 'latin1', 'ASCII', and 'bytes' are not allowed, as they can corrupt numerical data. Default: 'ASCII' Returns ------- result : array, tuple, dict, etc. Data stored in the file. For ``.npz`` files, the returned instance of NpzFile class must be closed to avoid leaking file descriptors. Raises ------ IOError If the input file does not exist or cannot be read. ValueError The file contains an object array, but allow_pickle=False given. See Also -------- save, savez, savez_compressed, loadtxt memmap : Create a memory-map to an array stored in a file on disk. lib.format.open_memmap : Create or load a memory-mapped ``.npy`` file. Notes ----- - If the file contains pickle data, then whatever object is stored in the pickle is returned. - If the file is a ``.npy`` file, then a single array is returned. - If the file is a ``.npz`` file, then a dictionary-like object is returned, containing ``{filename: array}`` key-value pairs, one for each file in the archive. - If the file is a ``.npz`` file, the returned value supports the context manager protocol in a similar fashion to the open function:: with load('foo.npz') as data: a = data['a'] The underlying file descriptor is closed when exiting the 'with' block. Examples -------- Store data to disk, and load it again: >>> np.save('/tmp/123', np.array([[1, 2, 3], [4, 5, 6]])) >>> np.load('/tmp/123.npy') array([[1, 2, 3], [4, 5, 6]]) Store compressed data to disk, and load it again: >>> a=np.array([[1, 2, 3], [4, 5, 6]]) >>> b=np.array([1, 2]) >>> np.savez('/tmp/123.npz', a=a, b=b) >>> data = np.load('/tmp/123.npz') >>> data['a'] array([[1, 2, 3], [4, 5, 6]]) >>> data['b'] array([1, 2]) >>> data.close() Mem-map the stored array, and then access the second row directly from disk: >>> X = np.load('/tmp/123.npy', mmap_mode='r') >>> X[1, :] memmap([4, 5, 6]) )rlatin1ryz.encoding must be 'ASCII', 'latin1', or 'bytes')encoding fix_importsrMFrbTsPKsPKr)rarZr[N)modertz@Cannot load file containing pickled data when allow_pickle=Falsez'Failed to interpret file %s as a pickle) ValueErrordict contextlib ExitStackrO enter_contextrurrrrrvrMseekmin startswithpop_allrT open_memmaprwrr2 ExceptionIOErrorrepr)rR mmap_moderZrrr[stackr`ra _ZIP_PREFIX _ZIP_SUFFIXNrzreter)r)r*r2sVp        % r2cC|fSr9r))rRarrrZrr)r)r*_save_dispatchersrcCst|dr t|}nt|}|ds|d}t|d}|}t|}tj |||t |ddWddS1s>> from tempfile import TemporaryFile >>> outfile = TemporaryFile() >>> x = np.arange(10) >>> np.save(outfile, x) >>> _ = outfile.seek(0) # Only needed here to simulate closing & reopening file >>> np.load(outfile) array([0, 1, 2, 3, 4, 5, 6, 7, 8, 9]) >>> with open('test.npy', 'wb') as f: ... np.save(f, np.array([1, 2])) ... np.save(f, np.array([1, 3])) >>> with open('test.npy', 'rb') as f: ... a = np.load(f) ... b = np.load(f) >>> print(a, b) # [1 2] [1 3] writerUwb)rrtN) rOr nullcontextrr\runp asanyarrayr write_arrayr)rRrrZrfile_ctxr`r)r)r*r3s =     "r3co|EdH|EdHdSr9valuesrRr'kwdsr)r)r*_savez_dispatcher rcOt|||ddS)a Save several arrays into a single file in uncompressed ``.npz`` format. Provide arrays as keyword arguments to store them under the corresponding name in the output file: ``savez(fn, x=x, y=y)``. If arrays are specified as positional arguments, i.e., ``savez(fn, x, y)``, their names will be `arr_0`, `arr_1`, etc. Parameters ---------- file : str or file Either the filename (string) or an open file (file-like object) where the data will be saved. If file is a string or a Path, the ``.npz`` extension will be appended to the filename if it is not already there. args : Arguments, optional Arrays to save to the file. Please use keyword arguments (see `kwds` below) to assign names to arrays. Arrays specified as args will be named "arr_0", "arr_1", and so on. kwds : Keyword arguments, optional Arrays to save to the file. Each array will be saved to the output file with its corresponding keyword name. Returns ------- None See Also -------- save : Save a single array to a binary file in NumPy format. savetxt : Save an array to a file as plain text. savez_compressed : Save several arrays into a compressed ``.npz`` archive Notes ----- The ``.npz`` file format is a zipped archive of files named after the variables they contain. The archive is not compressed and each file in the archive contains one variable in ``.npy`` format. For a description of the ``.npy`` format, see :py:mod:`numpy.lib.format`. When opening the saved ``.npz`` file with `load` a `NpzFile` object is returned. This is a dictionary-like object which can be queried for its list of arrays (with the ``.files`` attribute), and for the arrays themselves. When saving dictionaries, the dictionary keys become filenames inside the ZIP archive. Therefore, keys should be valid filenames. E.g., avoid keys that begin with ``/`` or contain ``.``. Examples -------- >>> from tempfile import TemporaryFile >>> outfile = TemporaryFile() >>> x = np.arange(10) >>> y = np.sin(x) Using `savez` with \*args, the arrays are saved with default names. >>> np.savez(outfile, x, y) >>> _ = outfile.seek(0) # Only needed here to simulate closing & reopening file >>> npzfile = np.load(outfile) >>> npzfile.files ['arr_0', 'arr_1'] >>> npzfile['arr_0'] array([0, 1, 2, 3, 4, 5, 6, 7, 8, 9]) Using `savez` with \**kwds, the arrays are saved with the keyword names. >>> outfile = TemporaryFile() >>> np.savez(outfile, x=x, y=y) >>> _ = outfile.seek(0) >>> npzfile = np.load(outfile) >>> sorted(npzfile.files) ['x', 'y'] >>> npzfile['x'] array([0, 1, 2, 3, 4, 5, 6, 7, 8, 9]) FN_savezrr)r)r*r4sPr4corr9rrr)r)r*_savez_compressed_dispatchermrrcOr)a Save several arrays into a single file in compressed ``.npz`` format. Provide arrays as keyword arguments to store them under the corresponding name in the output file: ``savez(fn, x=x, y=y)``. If arrays are specified as positional arguments, i.e., ``savez(fn, x, y)``, their names will be `arr_0`, `arr_1`, etc. Parameters ---------- file : str or file Either the filename (string) or an open file (file-like object) where the data will be saved. If file is a string or a Path, the ``.npz`` extension will be appended to the filename if it is not already there. args : Arguments, optional Arrays to save to the file. Please use keyword arguments (see `kwds` below) to assign names to arrays. Arrays specified as args will be named "arr_0", "arr_1", and so on. kwds : Keyword arguments, optional Arrays to save to the file. Each array will be saved to the output file with its corresponding keyword name. Returns ------- None See Also -------- numpy.save : Save a single array to a binary file in NumPy format. numpy.savetxt : Save an array to a file as plain text. numpy.savez : Save several arrays into an uncompressed ``.npz`` file format numpy.load : Load the files created by savez_compressed. Notes ----- The ``.npz`` file format is a zipped archive of files named after the variables they contain. The archive is compressed with ``zipfile.ZIP_DEFLATED`` and each file in the archive contains one variable in ``.npy`` format. For a description of the ``.npy`` format, see :py:mod:`numpy.lib.format`. When opening the saved ``.npz`` file with `load` a `NpzFile` object is returned. This is a dictionary-like object which can be queried for its list of arrays (with the ``.files`` attribute), and for the arrays themselves. Examples -------- >>> test_array = np.random.rand(3, 2) >>> test_vector = np.random.rand(4) >>> np.savez_compressed('/tmp/123', a=test_array, b=test_vector) >>> loaded = np.load('/tmp/123.npz') >>> print(np.array_equal(test_array, loaded['a'])) True >>> print(np.array_equal(test_vector, loaded['b'])) True TNrrr)r)r*r5rs?r5c Csddl}t|dst|}|ds|d}|}t|D]\}} d|} | |vr0td| | || <q|r;|j} n|j} t |d| d} | D].\} } | d} t | } | j | dd d }tj|| ||d Wdn1srwYqI| dS) Nrrz.npzzarr_%dz,Cannot use un-named variables and keyword %sw)r compressionrUT) force_zip64rt)rPrOrr\ enumeraterFr ZIP_DEFLATED ZIP_STOREDrSr}rrrurrrg)rRr'rcompressrZr[rPnamedictivalrDrzipffnamer`r)r)r*rs8      rcCsdd}|j}t|tjrddSt|tjrtjSt|tjr#tjSt|tjr-ddSt|tjr6tjSt|tjr>|St|t rGddSt|tj rOt St|tj rWt StS)z; Find the correct dtype converter. Adapted from matplotlib cSs"|d|vr t|St|S)N0x)lowerfloatfromhexrcr)r)r* floatconvs z_getconv..floatconvcS tt|Sr9)boolintrr)r)r* z_getconv..cSrr9)rrrr)r)r*rrcSstt|ddS)N+--)complexrreplacerr)r)r*r)type issubclassrbool_uint64int64integer longdoublefloatingrbytes_runicode_rr)dtypertypr)r)r*_getconvs*         riP)likec  Cs| fSr9r)) rrcomments delimiter convertersskiprowsusecolsunpackndminrmax_rowsrr)r)r*_loadtxt_dispatcherr#ryc s| durt|||| | d Stdd} tdd  fdd f d d } |d vrBtd |durftttfrPgd dDddDtd durnt }d}dkrzdd}durzt }Wn t yg}Ynw|D]}zt |Wqt y}z dt |f|_d}~ww|t|}t|| |\} d}z0t|trt|}t|rtjjj|ddtddtd}n t|t|ddWnt y}ztd|d}~wwdurn durddl}|ztD]}tq!d}z|s:t  }|r/WntyRd g}tj d|ddYnwt!pX|t!|d krid!d|Dnfd"dtDd kr~t"fg |pi#D]1\}}rz$|}Wn tyYqw|rd#d$}t%j&||d%|<q||<qfd&dDd| t'D]2}durt(||qt j)}|d}|dt!|7<j*|dd'||dd(f<qW|r+n |r +wwdurt(g|j,d)kr)j)ddd*kr)d+_)j,|kr4t-j,|krP|d krEt.n |dkrPt/j0|rgt!|d krdfd,d|j1DSj0SS)-a Load data from a text file. Each row in the text file must have the same number of values. Parameters ---------- fname : file, str, or pathlib.Path File, filename, or generator to read. If the filename extension is ``.gz`` or ``.bz2``, the file is first decompressed. Note that generators should return byte strings. dtype : data-type, optional Data-type of the resulting array; default: float. If this is a structured data-type, the resulting array will be 1-dimensional, and each row will be interpreted as an element of the array. In this case, the number of columns used must match the number of fields in the data-type. comments : str or sequence of str, optional The characters or list of characters used to indicate the start of a comment. None implies no comments. For backwards compatibility, byte strings will be decoded as 'latin1'. The default is '#'. delimiter : str, optional The string used to separate values. For backwards compatibility, byte strings will be decoded as 'latin1'. The default is whitespace. converters : dict, optional A dictionary mapping column number to a function that will parse the column string into the desired value. E.g., if column 0 is a date string: ``converters = {0: datestr2num}``. Converters can also be used to provide a default value for missing data (but see also `genfromtxt`): ``converters = {3: lambda s: float(s.strip() or 0)}``. Default: None. skiprows : int, optional Skip the first `skiprows` lines, including comments; default: 0. usecols : int or sequence, optional Which columns to read, with 0 being the first. For example, ``usecols = (1,4,5)`` will extract the 2nd, 5th and 6th columns. The default, None, results in all columns being read. .. versionchanged:: 1.11.0 When a single column has to be read it is possible to use an integer instead of a tuple. E.g ``usecols = 3`` reads the fourth column the same way as ``usecols = (3,)`` would. unpack : bool, optional If True, the returned array is transposed, so that arguments may be unpacked using ``x, y, z = loadtxt(...)``. When used with a structured data-type, arrays are returned for each field. Default is False. ndmin : int, optional The returned array will have at least `ndmin` dimensions. Otherwise mono-dimensional axes will be squeezed. Legal values: 0 (default), 1 or 2. .. versionadded:: 1.6.0 encoding : str, optional Encoding used to decode the inputfile. Does not apply to input streams. The special value 'bytes' enables backward compatibility workarounds that ensures you receive byte arrays as results if possible and passes 'latin1' encoded strings to converters. Override this value to receive unicode arrays and pass strings as input to converters. If set to None the system default is used. The default value is 'bytes'. .. versionadded:: 1.14.0 max_rows : int, optional Read `max_rows` lines of content after `skiprows` lines. The default is to read all the lines. .. versionadded:: 1.16.0 ${ARRAY_FUNCTION_LIKE} .. versionadded:: 1.20.0 Returns ------- out : ndarray Data read from the text file. See Also -------- load, fromstring, fromregex genfromtxt : Load data with missing values handled as specified. scipy.io.loadmat : reads MATLAB data files Notes ----- This function aims to be a fast reader for simply formatted files. The `genfromtxt` function provides more sophisticated handling of, e.g., lines with missing values. .. versionadded:: 1.10.0 The strings produced by the Python float.hex method can be used as input for floats. Examples -------- >>> from io import StringIO # StringIO behaves like a file object >>> c = StringIO("0 1\n2 3") >>> np.loadtxt(c) array([[0., 1.], [2., 3.]]) >>> d = StringIO("M 21 72\nF 35 58") >>> np.loadtxt(d, dtype={'names': ('gender', 'age', 'weight'), ... 'formats': ('S1', 'i4', 'f4')}) array([(b'M', 21, 72.), (b'F', 35, 58.)], dtype=[('gender', 'S1'), ('age', '>> c = StringIO("1,0,2\n3,0,4") >>> x, y = np.loadtxt(c, delimiter=',', usecols=(0, 2), unpack=True) >>> x array([1., 3.]) >>> y array([2., 4.]) This example shows how `converters` can be used to convert a field with a trailing minus sign into a negative number. >>> s = StringIO('10.01 31.25-\n19.22 64.31\n17.57- 63.94') >>> def conv(fld): ... return -float(fld[:-1]) if fld.endswith(b'-') else float(fld) ... >>> np.loadtxt(s, converters={0: conv, 1: conv}) array([[ 10.01, -31.25], [ 19.22, 64.31], [-17.57, 63.94]]) N) rrrrrrrrrrrc Ss|jdurG|j}t|dkr|jgdfS|dtfg}t|dkr9|jdddD]}||dd||fg}q)|jgtt|j|fSg}g}|jD](}|j|\}}||\} } | | |j dkrm| | qN| t| | fqN||fS)z;Unpack a structured data-type, and produce re-packing info.Nrr) namesshaperrbaserErrprodfieldsextendndimr]) r=dtrpackingdimtypesfieldtpryflat_dt flat_packingr)r)r*flatten_dtype_internals&         z'loadtxt..flatten_dtype_internalcSsr|dur|dS|turt|S|turt|Sd}g}|D]\}}|||||||||7}qt|S)z6Pack items into nested lists based on re-packing info.Nr)tuplerEr])r=r}rstartrlength subpackingr)r)r* pack_itemss  zloadtxt..pack_itemscsBt|d}durj|ddd}|d}|r|SgS)z2Chop off comments, strip, and split at delimiter. rNr)maxsplitrz )rsplitstrip)line)rrrregex_commentsr)r* split_lines  zloadtxt..split_linec3sg}tg}t|}t|D]K\}} |tdkr#q r.fdd Dtkr@|d}td|ddtD}|}||t||kr_|Vg}q|rg|VdSdS)aParse each line, including the first. The file read, `fh`, is a global defined above. Parameters ---------- chunk_size : int At most `chunk_size` lines are read at a time, with iteration until all lines are read. rcg|]}|qSr)r)).0jvalsr)r* rz.loadtxt..read_data..rz"Wrong number of columns at line %dcSsg|]\}}||qSr)r))rconvrr)r)r*rN) itertoolschainislicerrrrr^r]) chunk_sizeX line_iterrrline_numr}) rrfh first_linerrrrrrrr* read_datas2         zloadtxt..read_data)rrr z"Illegal value of ndmin keyword: %scSg|]}t|qSr))r)rrcr)r)r*rrzloadtxt..css|]}t|VqdSr9)reescape)rcommentr)r)r* szloadtxt..|FryTz\usecols must be an int or a sequence of ints but it contains at least one element of type %srtrrrz1fname must be a string, file handle, or generatorrzloadtxt: Empty input file: "%s"r r!rcSrr))r)rrr)r)r*rYrcsg|]}qSr)r)rr)defconvr)r*r\scS"t|tur ||S||dSNrrryencodercr r)r)r* tobytes_firstl zloadtxt..tobytes_firstr cs$g|]}|tur |nfddqS)cs |Sr9)r"r fencodingr)r*rus z$loadtxt...)ryrr r'r)r*rts  )refcheck.)rr)rrcrr)r)rr)rr)r*rr)2_loadtxt_with_liker r isinstancestrryrcompilejoinrrE TypeErroropindexrr'rrrrrrlib _datasourcerugetattrrolocalegetpreferredencodingrangenext StopIterationr#r$rrrr}r functoolspartial_loadtxt_chunksizearrayrresizergrsqueeze atleast_1d atleast_2dTr)rrrrrrrrrrrrrruser_convertersbyte_convertersusecols_as_listcol_idxr dtype_typesfownr7r first_valsr r$rcnshapeposr))rrrrrrrr(rrrrrrrrrr*r,s    +                                   r,c Crr9r)) rrfmtrnewlineheaderfooterrrr)r)r*_savetxt_dispatcherrrR%.18e  r# c  Cs t|tr t|}t|}Gddd} d} t|trt|}t|r7t|dtj j j|d|d} d} nt |drD| ||pAd} nt d z=t |}|jd ksY|jd kr`t d |j|jd kr{|jjdurtt|j}d } n t|jj} n|jd } t|} t|ttfvrt|| krtdt|t|tt|}nGt|tr|d}t d|}|d kr| rd||fg| }n|g| }||}n| r|d | kr|| s|| kr||}nt d|ft|d kr|dd|}| |||| r4|D](}g}|D]}| |j!| |j"q|t||}| |ddq n/|D],}z |t||}Wnt#y[}z t#dt|j|f|d}~ww| |q6t|d kr{|dd|}| |||W| r| dSdS| r| ww)a Save an array to a text file. Parameters ---------- fname : filename or file handle If the filename ends in ``.gz``, the file is automatically saved in compressed gzip format. `loadtxt` understands gzipped files transparently. X : 1D or 2D array_like Data to be saved to a text file. fmt : str or sequence of strs, optional A single format (%10.5f), a sequence of formats, or a multi-format string, e.g. 'Iteration %d -- %10.5f', in which case `delimiter` is ignored. For complex `X`, the legal options for `fmt` are: * a single specifier, `fmt='%.4e'`, resulting in numbers formatted like `' (%s+%sj)' % (fmt, fmt)` * a full string specifying every real and imaginary part, e.g. `' %.4e %+.4ej %.4e %+.4ej %.4e %+.4ej'` for 3 columns * a list of specifiers, one per column - in this case, the real and imaginary part must have separate specifiers, e.g. `['%.3e + %.3ej', '(%.15e%+.15ej)']` for 2 columns delimiter : str, optional String or character separating columns. newline : str, optional String or character separating lines. .. versionadded:: 1.5.0 header : str, optional String that will be written at the beginning of the file. .. versionadded:: 1.7.0 footer : str, optional String that will be written at the end of the file. .. versionadded:: 1.7.0 comments : str, optional String that will be prepended to the ``header`` and ``footer`` strings, to mark them as comments. Default: '# ', as expected by e.g. ``numpy.loadtxt``. .. versionadded:: 1.7.0 encoding : {None, str}, optional Encoding used to encode the outputfile. Does not apply to output streams. If the encoding is something other than 'bytes' or 'latin1' you will not be able to load the file in NumPy versions < 1.14. Default is 'latin1'. .. versionadded:: 1.14.0 See Also -------- save : Save an array to a binary file in NumPy ``.npy`` format savez : Save several arrays into an uncompressed ``.npz`` archive savez_compressed : Save several arrays into a compressed ``.npz`` archive Notes ----- Further explanation of the `fmt` parameter (``%[flag]width[.precision]specifier``): flags: ``-`` : left justify ``+`` : Forces to precede result with + or -. ``0`` : Left pad the number with zeros instead of space (see width). width: Minimum number of characters to be printed. The value is not truncated if it has more characters. precision: - For integer specifiers (eg. ``d,i,o,x``), the minimum number of digits. - For ``e, E`` and ``f`` specifiers, the number of digits to print after the decimal point. - For ``g`` and ``G``, the maximum number of significant digits. - For ``s``, the maximum number of characters. specifiers: ``c`` : character ``d`` or ``i`` : signed decimal integer ``e`` or ``E`` : scientific notation with ``e`` or ``E``. ``f`` : decimal floating point ``g,G`` : use the shorter of ``e,E`` or ``f`` ``o`` : signed octal ``s`` : string of characters ``u`` : unsigned decimal integer ``x,X`` : unsigned hexadecimal integer This explanation of ``fmt`` is not complete, for an exhaustive specification see [1]_. References ---------- .. [1] `Format Specification Mini-Language `_, Python Documentation. Examples -------- >>> x = y = z = np.arange(0.0,5.0,1.0) >>> np.savetxt('test.out', x, delimiter=',') # X is an array >>> np.savetxt('test.out', (x,y,z)) # x,y,z equal sized 1D arrays >>> np.savetxt('test.out', x, fmt='%1.4e') # use exponential notation c@s@eZdZdZddZddZddZdd Zd d Zd d Z dS)zsavetxt..WriteWrapz0Convert to bytes on bytestream inputs. cSs||_||_|j|_dSr9)rr first_writedo_write)r=rrr)r)r*r?6s z#savetxt..WriteWrap.__init__cSs|jdSr9)rrgrGr)r)r*rg;z savetxt..WriteWrap.closecSs||dSr9)rXr=vr)r)r*r>rYz savetxt..WriteWrap.writecSs2t|tr |j|dS|j||jdSr9)r.ryrrr"rrZr)r)r* write_bytesAs z&savetxt..WriteWrap.write_bytescSs|jt|dSr9)rrrrZr)r)r* write_normalGsz'savetxt..WriteWrap.write_normalcSs@z |||j|_WdSty|||j|_YdSwr9)r]rr2r\rZr)r)r*rWJs   z&savetxt..WriteWrap.first_writeN) rIrJrKrLr?rgrr\r]rWr)r)r)r* WriteWrap2s r^FwtrTrrz%fname must be a string or file handlerr z.Expected 1D or 2D array, got %dD array insteadrNzfmt has wrong shape. %s%z'fmt has wrong number of %% formats: %sz (%s+%sj)zinvalid fmt: %rrUrrz?Mismatch between array dtype ('%s') and format specifier ('%s'))$r.ryrrrrrurgrr4r5rOrasarrayrrrrCrDrrr iscomplexobjrrErrCr/r1mapcountrrr]realimagr2)rrrNrrOrPrQrrr^own_fhrncol iscomplex_Xr n_fmt_charserrorrowrow2numbersr[rr)r)r*r+s |!                   r+c Csd}t|dstjjj|d|d}d}znt|tjst|}|}t|tr4t|tj j r4t |}nt|tj j rDt|trDt |}t|dsNt |}||}|rqt|dtsqt||jd}tj||d}||_ntj||d}|W|r|SS|r|ww) a  Construct an array from a text file, using regular expression parsing. The returned array is always a structured array, and is constructed from all matches of the regular expression in the file. Groups in the regular expression are converted to fields of the structured array. Parameters ---------- file : str or file Filename or file object to read. regexp : str or regexp Regular expression used to parse the file. Groups in the regular expression correspond to fields in the dtype. dtype : dtype or list of dtypes Dtype for the structured array. encoding : str, optional Encoding used to decode the inputfile. Does not apply to input streams. .. versionadded:: 1.14.0 Returns ------- output : ndarray The output array, containing the part of the content of `file` that was matched by `regexp`. `output` is always a structured array. Raises ------ TypeError When `dtype` is not a valid dtype for a structured array. See Also -------- fromstring, loadtxt Notes ----- Dtypes for structured arrays can be specified in several forms, but all forms specify at least the data type and field name. For details see `basics.rec`. Examples -------- >>> f = open('test.dat', 'w') >>> _ = f.write("1312 foo\n1534 bar\n444 qux") >>> f.close() >>> regexp = r"(\d+)\s+(...)" # match [digits, whitespace, anything] >>> output = np.fromregex('test.dat', regexp, ... [('num', np.int64), ('key', 'S3')]) >>> output array([(1312, b'foo'), (1534, b'bar'), ( 444, b'qux')], dtype=[('num', '>> output['num'] array([1312, 1534, 444]) FrMrrTmatchrr)rOrr4r5rur.rrMrycompatunicoderrrr0findallrrr?rg) rRregexprrrgcontentseqnewdtypeoutputr)r)r*r6s4<         r6cCs|fSr9r))rrrr skip_header skip_footerrmissing_valuesfilling_valuesrr excludelist deletechars replace_space autostripcase_sensitive defaultfmtrusemaskloose invalid_raiserrrr)r)r*_genfromtxt_dispatcher sr_zf%icRs~|durOt|fidd|d|d d|d|d|d |d | d d | d | d| d|d|dd|d|d|d|d|d|d|S|dura|rYtd|dkratd|rkddlm}m}|pni}t|ts|tdt||dkrd}d }nd!}z+t|t rt |}t|t rt j jj|d"|d#}t|}n|}t|}t|}Wnty}z td$t||d}~ww|t||||d%} t| | || d&}!z:t D]t|qd}"|"stt||}#d ur|dur||#vrd'|#|dd}#| |#}"|"rWnty-d'}#g}"tjd(|d)d*Ynwd urF|"d}$|durF|$|vrF|"d=| durvz d+d,| d-D} Wntyuzt | } Wn tyr| g} YnwYnwt!| p{|"}%d ur|!d.d,|"Dd'}#nt"r|!d/d,d-Dnr|!durt#| | || d0durt | rt$| D] \}&t"|&rو%|&| <q|&dkr|&t!|"| <qLjdur t!|%kr j&t 'fd1d,| Dt j(n%durt!|%krfd2d,| Dndur.dur.t j(|p2d3}'t|'t)r>|'*d4}'d5d,t|%D}t|'tr|'+D]`\}(})t"|(rmz%|(}(Wn tylYqQw| rz| %|(}(Wn tyYnwt|)t t,frd6d,|)D})nt |)g})|(dur|D]}*|*-|)qqQ||(-|)qQnGt|'t t,frt.|'|D]\}+},t |+}+|+|,vr|,/|+qn%t|'t r|'d-}-|D]},|,-|-qn|D] },|,-t |'gq|}.|.durg}.dg|%}t|.trJ|.+D]6\}(})t"|(r.z%|(}(Wn ty-Yqw| rCz| %|(}(Wn tyBYnw|)||(<qn$t|.t t,frit!|.}/|/|%krb|.|d|/<n |.d|%}n|.g|%}dur~d7d,t.||D}n)t0d d8}0t!|0dkrt.|0||}1d9d,|1D}nt.||}1fd:d,|1D}g}2|+D]s\}3t"|3rz %|3}3|3Wn#tyYqw| rz| %|3Wn tyYqw|3t!|#r|"|3}4nd}4t)urt1}5n|rd;d<}6t2j3|6d=}5n}5|j4|5d |4||d>|2/|5fq|4|2g j/}7|r3g}8|8j/}9g}:|:j/};t$t56|#g|D]i\}<| |< t! }=|=dkrTqA| rxz fd?d,| D Wn&t7yw|; d|=fYqAw|=|%kr|; d|=fqA|7t, |r|9t,d@d,t. |Dt! |krnqAWdn 1swYdurt$|D]X\}>fdAd, D}?z|>8|?Wqt9ydB}@t:t; }?t$|?D](\}3}+z|><|+Wqt=tfy|@dC7}@|@|3d |+f;}@t=|@wYqwt!|:}A|Adkrwt! |A|dD|% |dkrOt! fdEd,|:D}B|:d|A|B}:||B8} fdFd,|:D}@t!|@rw|@>ddGdH|@}@|rot|@tj|@t?d)d*|dkr d|  |r|8d| }8|rt t. fdId,t$|D nt t. fdJd,t$|D }CdurdKd,|D}DdLd,t$|DD |r rtjdMt j@d)d* fdNdOz fdPd,|CD}CWn tAyYn w D]t jB|D<q|Ddd}Et$|DD]\}Ft C|Ft jDr#tEfdQdR|CD}G|F|Gf|E<qdur^dSdTt.||DD}Ht!|HdkrD|H\}I|ItF}J}Kn-fdUd,t$|ED}J|r]fdVd,t$|ED}Knt t.|E}Jt t.tFgt!|E}Kt jG|C|JdW|rt jG|8|KdW}Ln؈rj(dur_(t!|0dkrdXdYdR|0DvrtHrtIdZt jG|CdWnt jG|Cd[d,|0DdW J|rt jG|8t 'd\d,|0DdW}M|}K|MJ|K}Ln}|r:d }Ngt$d]d,|DD]6\}O|vr|N|OjkM}Nt C|Ot jDr|OtEfd^dR|CDf}O/d'|Ofq/d'fq|Ns:t!dkr5t 'nt '|Ot G|C|r[j(durRd_d,j(D}KntF}Kt jG|8|KdW}Lj'j(|rrt.|D]!\}Pfd`d,jKD}|D]}Q|L|P|P|QkO<qzqj|rJ||L_Lt M|rdurjNSt!dkrdSfdad,DSS)ba Load data from a text file, with missing values handled as specified. Each line past the first `skip_header` lines is split at the `delimiter` character, and characters following the `comments` character are discarded. Parameters ---------- fname : file, str, pathlib.Path, list of str, generator File, filename, list, or generator to read. If the filename extension is `.gz` or `.bz2`, the file is first decompressed. Note that generators must return byte strings. The strings in a list or produced by a generator are treated as lines. dtype : dtype, optional Data type of the resulting array. If None, the dtypes will be determined by the contents of each column, individually. comments : str, optional The character used to indicate the start of a comment. All the characters occurring on a line after a comment are discarded. delimiter : str, int, or sequence, optional The string used to separate values. By default, any consecutive whitespaces act as delimiter. An integer or sequence of integers can also be provided as width(s) of each field. skiprows : int, optional `skiprows` was removed in numpy 1.10. Please use `skip_header` instead. skip_header : int, optional The number of lines to skip at the beginning of the file. skip_footer : int, optional The number of lines to skip at the end of the file. converters : variable, optional The set of functions that convert the data of a column to a value. The converters can also be used to provide a default value for missing data: ``converters = {3: lambda s: float(s or 0)}``. missing : variable, optional `missing` was removed in numpy 1.10. Please use `missing_values` instead. missing_values : variable, optional The set of strings corresponding to missing data. filling_values : variable, optional The set of values to be used as default when the data are missing. usecols : sequence, optional Which columns to read, with 0 being the first. For example, ``usecols = (1, 4, 5)`` will extract the 2nd, 5th and 6th columns. names : {None, True, str, sequence}, optional If `names` is True, the field names are read from the first line after the first `skip_header` lines. This line can optionally be preceeded by a comment delimiter. If `names` is a sequence or a single-string of comma-separated names, the names will be used to define the field names in a structured dtype. If `names` is None, the names of the dtype fields will be used, if any. excludelist : sequence, optional A list of names to exclude. This list is appended to the default list ['return','file','print']. Excluded names are appended with an underscore: for example, `file` would become `file_`. deletechars : str, optional A string combining invalid characters that must be deleted from the names. defaultfmt : str, optional A format used to define default field names, such as "f%i" or "f_%02i". autostrip : bool, optional Whether to automatically strip white spaces from the variables. replace_space : char, optional Character(s) used in replacement of white spaces in the variable names. By default, use a '_'. case_sensitive : {True, False, 'upper', 'lower'}, optional If True, field names are case sensitive. If False or 'upper', field names are converted to upper case. If 'lower', field names are converted to lower case. unpack : bool, optional If True, the returned array is transposed, so that arguments may be unpacked using ``x, y, z = genfromtxt(...)``. When used with a structured data-type, arrays are returned for each field. Default is False. usemask : bool, optional If True, return a masked array. If False, return a regular array. loose : bool, optional If True, do not raise errors for invalid values. invalid_raise : bool, optional If True, an exception is raised if an inconsistency is detected in the number of columns. If False, a warning is emitted and the offending lines are skipped. max_rows : int, optional The maximum number of rows to read. Must not be used with skip_footer at the same time. If given, the value must be at least 1. Default is to read the entire file. .. versionadded:: 1.10.0 encoding : str, optional Encoding used to decode the inputfile. Does not apply when `fname` is a file object. The special value 'bytes' enables backward compatibility workarounds that ensure that you receive byte arrays when possible and passes latin1 encoded strings to converters. Override this value to receive unicode arrays and pass strings as input to converters. If set to None the system default is used. The default value is 'bytes'. .. versionadded:: 1.14.0 ${ARRAY_FUNCTION_LIKE} .. versionadded:: 1.20.0 Returns ------- out : ndarray Data read from the text file. If `usemask` is True, this is a masked array. See Also -------- numpy.loadtxt : equivalent function when no data is missing. Notes ----- * When spaces are used as delimiters, or when no delimiter has been given as input, there should not be any missing data between two fields. * When the variables are named (either by a flexible dtype or with `names`), there must not be any header in the file (else a ValueError exception is raised). * Individual values are not stripped of spaces by default. When using a custom converter, make sure the function does remove spaces. References ---------- .. [1] NumPy User Guide, section `I/O with NumPy `_. Examples -------- >>> from io import StringIO >>> import numpy as np Comma delimited file with mixed dtype >>> s = StringIO(u"1,1.3,abcde") >>> data = np.genfromtxt(s, dtype=[('myint','i8'),('myfloat','f8'), ... ('mystring','S5')], delimiter=",") >>> data array((1, 1.3, b'abcde'), dtype=[('myint', '>> _ = s.seek(0) # needed for StringIO example only >>> data = np.genfromtxt(s, dtype=None, ... names = ['myint','myfloat','mystring'], delimiter=",") >>> data array((1, 1.3, b'abcde'), dtype=[('myint', '>> _ = s.seek(0) >>> data = np.genfromtxt(s, dtype="i8,f8,S5", ... names=['myint','myfloat','mystring'], delimiter=",") >>> data array((1, 1.3, b'abcde'), dtype=[('myint', '>> s = StringIO(u"11.3abcde") >>> data = np.genfromtxt(s, dtype=None, names=['intvar','fltvar','strvar'], ... delimiter=[1,3,5]) >>> data array((1, 1.3, b'abcde'), dtype=[('intvar', '>> f = StringIO(''' ... text,# of chars ... hello world,11 ... numpy,5''') >>> np.genfromtxt(f, dtype='S12,S12', delimiter=',') array([(b'text', b''), (b'hello world', b'11'), (b'numpy', b'5')], dtype=[('f0', 'S12'), ('f1', 'S12')]) Nrrrrzr{rr|r}rrr~rrrrrrrrrrrrzPThe keywords 'skip_footer' and 'max_rows' can not be specified at the same time.rz'max_rows' must be at least 1.r) MaskedArraymake_mask_descrzNThe input argument 'converter' should be a valid dictionary (got '%s' instead)ryTFrrzRfname must be a string, filehandle, list of strings, or generator. Got %s instead.)rrrr)r~rrrrz"genfromtxt: Empty input file: "%s"r r!cSg|]}|qSr)rrrr)r)r*r3rzgenfromtxt..,cSsg|]}t|qSr))r/rrr)r)r*r=r cSrr)rrr)r)r*r@r)rrr~rrrcrr)r)r)descrr)r*rXrcrr)r)r)rr)r*r\rr)rcSsg|]}tdgqSr)rErr)r)r*rgcSrr))r/rr)r)r*r}rcSsg|] \}}td||dqS)N)r|defaultrrmissfillr)r)r*rs) flatten_basecSs"g|] \}}}t|d||dqST)lockedr|rr)rrrrr)r)r*rs  cs g|] \}}td||dqSrrrrqr)r*rs  cSrr r!r#r)r)r*r$r%z!genfromtxt..tobytes_firstr&)r testing_valuerr|crr)r)rrr)r*rrcSsg|] \}}||vqSr)r)rr[mr)r)r*rcsg|]}t|qSr))r)r_mrr)r*r'r z0Converter #%i is locked and cannot be upgraded: z"(occurred line #%i for value '%s')z- Line #%%i (got %%i columns instead of %i)cs g|] }|dkr|qS)rr)r)nbrowsrzr)r*r<scsg|] \}}||fqSr)r))rrnb)templater)r*rErzSome errors were detected !rUc,g|]\}fddtt|DqS)cg|]}|qSr)) _loose_callr_rr&r)r*r[r)genfromtxt...rcrrrowsr&r*r[ cr)crr)) _strict_callrr&r)r*r_rrrrrr&r*r_rcSg|]}|jqSr)rr)r)r)r*rfcSsg|] \}}|tjkr|qSr))rr)rrr[r)r)r*rhs zReading unicode strings without specifying the encoding argument is deprecated. Set the encoding, use None for the system default.cs,t|}D] }||d||<qt|Sr )rEr"r)row_tuprlr) strcolidxr)r*encode_unicode_colsrsz'genfromtxt..encode_unicode_colscsg|]}|qSr)r))rr)rr)r*ryrc3|] }t|VqdSr9rrrrlrr)r*rzgenfromtxt..cSsh|] \}}|jr|qSr))_checked)rcc_typer)r)r* s zgenfromtxt..csg|] \}}||fqSr)r)rrrrr)r*rrcsg|] \}}|tfqSr)rrrr)r*rrrqOcss|]}|jVqdSr9)charrr)r)r*rsz4Nested fields involving objects are not supported...cSsg|]}d|fqSrr)rr)r)r*rrcSsg|]}dtfqSrr)rtr)r)r*rrcSrr)rr)r)r)r*rrc3rr9rrrr)r*rrcSsg|]}|tfqSr)rrr)r)r*rrcsg|] }|dkr|qSrr)rr&r)r*rscrr)r)r,)ryr)r*rr)O_genfromtxt_with_likernumpy.marrr.rr2rrrr/rr4r5rurclosingrrorrr9r:rr1rr;r#r$rrCrErrrrrrrrrrydecoder}rrr^r]rrr<r=updater r  IndexError iterupgraderrcrupgraderinsertrVisibleDeprecationWarningUnicodeEncodeErrorr issubdtype charactermaxrr?rNotImplementedErrorviewr|_maskrArD)Rrrrrrzr{rr|r}rrr~rrrrrrrrrrrrrrrErFr`fid_ctxfhdrrvalidate_names first_valuesrfvalnbcolscurrentuser_missing_valuesrDrrvalueentry user_valueuser_filling_valuesn dtype_flatzipit uc_updaterr user_convr$append_to_rowsmasksappend_to_masksinvalidappend_to_invalidrnbvalues convertercurrent_columnerrmsg nbinvalidnbinvalid_skippeddata column_typessized_column_typescol_typen_charsr uniform_typeddtypemdtype outputmaskrowmasks ishomogeneousttypenamemvalr))r rrrrrrrryrrzrrrr*r-s@                                                                                                r-cK(d|d<tjdtddt|fi|S)a Load ASCII data stored in a file and return it as a single array. .. deprecated:: 1.17 ndfromtxt` is a deprecated alias of `genfromtxt` which overwrites the ``usemask`` argument with `False` even when explicitly called as ``ndfromtxt(..., usemask=True)``. Use `genfromtxt` instead. Parameters ---------- fname, kwargs : For a description of input parameters, see `genfromtxt`. See Also -------- numpy.genfromtxt : generic function. FrzGnp.ndfromtxt is a deprecated alias of np.genfromtxt, prefer the latter.r r!r#r$r%r-rr(r)r)r*r. r.cKr)a  Load ASCII data stored in a text file and return a masked array. .. deprecated:: 1.17 np.mafromtxt is a deprecated alias of `genfromtxt` which overwrites the ``usemask`` argument with `True` even when explicitly called as ``mafromtxt(..., usemask=False)``. Use `genfromtxt` instead. Parameters ---------- fname, kwargs : For a description of input parameters, see `genfromtxt`. See Also -------- numpy.genfromtxt : generic function to load ASCII data. TrzGnp.mafromtxt is a deprecated alias of np.genfromtxt, prefer the latter.r r!rrr)r)r*r/ rr/cKsV|dd|dd}t|fi|}|r#ddlm}||}|S|tj}|S)a Load ASCII data from a file and return it in a record array. If ``usemask=False`` a standard `recarray` is returned, if ``usemask=True`` a MaskedRecords array is returned. Parameters ---------- fname, kwargs : For a description of input parameters, see `genfromtxt`. See Also -------- numpy.genfromtxt : generic function Notes ----- By default, `dtype` is None, which means that the data-type of the output array will be determined from the data. rNrFr MaskedRecords) setdefaultgetr-numpy.ma.mrecordsrrrrecarray)rr(rryrr)r)r*r0, s     r0cKsz|dd|dd|dd|ddt|fi|}|d d }|r5d d lm}||}|S|tj}|S) a8 Load ASCII data stored in a comma-separated file. The returned array is a record array (if ``usemask=False``, see `recarray`) or a masked record array (if ``usemask=True``, see `ma.mrecords.MaskedRecords`). Parameters ---------- fname, kwargs : For a description of input parameters, see `genfromtxt`. See Also -------- numpy.genfromtxt : generic function to load ASCII data. Notes ----- By default, `dtype` is None, which means that the data-type of the output array will be determined from the data. rrrTrrrNrFrr)rr-rrrrrr)rr(ryrrr)r)r*r1L s        r1)NFTr)NN)TT)TN) NNNNNNNNNN)NNNNNNN)rSrTrUrrrVNr9)NNNNNNNNNNNNNNNNNNNNNN)Ssysosrr<r r#r:roperatorrrr3collections.abcrrrrrr5r numpy.corernumpy.core.multiarrayr r numpy.core.overridesr r numpy.core._internalr _iotoolsrrrrrrrrrrr numpy.compatrrrrrrr&__all__r=array_function_dispatchr8rSrTr2rr3rr4rr5rrr>rrr,r-rRr+r6rr1sorteddefaultdeletecharsr-rr.r/r0r1r)r)r)r*s     4  1*  * J R  A%! %  x b  Z